Bacterial taxon 155864
Locus Z2914
Protein AAG56852.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 233 aa, Gene n/a, UniProt n/a
>AAG56852.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MKKCVIKIYIAPPEKINFLCYYVYSYLFQWNDNVNINYPAEYEIGDKVFTCIGAALFGQISAASNCWSNHVGIIIGHNGEDFLVAESRVPLSTITTLSRFIKRSSNQRYAIKRLDAGLTEQQKQRIVEQVPSRLRKLYHTGFKYESSRQFCSKFVFDIYKEALCIPVGEIETFGELLNSNPNAKLTFWKFWFLGSIPWERKTVTPASLWHHPGLVLIHAEGVETPQPELTEAV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,623,559 | -4.68 | 0.049 | ●●○○○ -1.61 | -1.609954791535312 | 21278291 |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)