Bacterial taxon 155864
Locus Z4071
Protein AAG57869.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 50 aa, Gene n/a, UniProt n/a
>AAG57869.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,674,694 | -5.19 | 0.033 | ●●○○○ -1.84 | -1.8404223120213954 | 21278291 |
Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,674,689 | -3.9 | 0.081 | ●●○○○ -1.26 | -1.2605007660745833 | 21278291 |
Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,674,695 | 0.41 | 0.14 | ○○○○○ 0.67 | 0.6701163908936986 | 21278291 |
Retrieved 3 of 3 entries in 2.5 ms
(Link to these results)