Bacterial taxon 155864   Locus Z0794   Protein AAG54980.1

orf, hypothetical protein

Escherichia coli O157:H7 str. EDL933

Length 235 aa, Gene n/a, UniProt n/a

>AAG54980.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MDMESQKILFALSTPMEIRNECCLPSHSSPKMYLGTRFFDLSSSWGIDDRDDLLRTIHRMIDNGHAARLAGFYHRWFRYSPCEWRDYLAELNEQGQAYAQFVASTAECCGEGGIKAWDYVRMGFLSRMGVLNNWLSEEESLWIQSRIHLRALRYYSNWRQYFAGYTFGRQYWQSPEDDNLPLLREFLARKEYDDSGNDMFYQLFASDDAYYATLPWQPLADYPTCPETLKDMSDL

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Cow (Bos taurus)feces BTO:00004405 days758,072 -4.830.044●●○○○ -1.68-1.67615519621112121278291
Retrieved 1 of 1 entries in 13.6 ms (Link to these results)