Bacterial taxon 155864
Locus Z1546
Protein AAG55661.1
putative fatty acyl chain dehydrase
Escherichia coli O157:H7 str. EDL933
Length 182 aa, Gene n/a, UniProt n/a
>AAG55661.1|Escherichia coli O157:H7 str. EDL933|putative fatty acyl chain dehydrase
MSKYTIPSKIFLEMGGWRQPLLMVDKIADYKYGENGFVSVVKHVTYNEPYLLGHFPEDPIMPGVIISEIFGQASEYLSFLTDICDIWRERFEEELKSLRDIHARIHRPEMLEIIRTWRSQVRGVLAAQNLKFKDIAYPGDSIDVVSKLAFSDASGFKHYSVTAYVGKKLISQGTIINFRETK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,440,913 | -4.66 | 0.05 | ●●○○○ -1.6 | -1.6004437502722069 | 21278291 |
Retrieved 1 of 1 entries in 11.4 ms
(Link to these results)