Bacterial taxon 155864
Locus Z5051
Protein AAG58771.1
putative LPS biosynthesis enzyme
Escherichia coli O157:H7 str. EDL933
Length 337 aa, Gene n/a, UniProt n/a
>AAG58771.1|Escherichia coli O157:H7 str. EDL933|putative LPS biosynthesis enzyme
MDFKHLTQFKDIIELDKRPVKLDERETFNVSWGIDENYQVGAAISIASILENNKQNKFTFHIIADYLDKEYIELLSQLATKYQTVIKLYHIDSEPLKALPQSNIWPVSIYYRLLSFDYFSARLDSLLYLDADIVCKGSLNELIALEFKDEYGAVVIDVDAMQSKSAERLCNEDFNGSYFNSGVMYINLREWLKQRLTEKFFDLLSDESIIKKLKYPDQDILNLMFLHHAKILPRKYNCIYTIKSEFEEKNSEYYTRFINDDTVFIHYTGITKPWHDWANYASADYFRNIYNISPWRNIPYKKAVKKHEYKEKYKHLLYQKKFLDGVFTAIKYNVMKG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,615,714 | -5.94 | 0.017 | ●●●○○ -2.18 | -2.1768421391839006 | 21278291 |
Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,615,875 | -5.38 | 0.028 | ●●○○○ -1.93 | -1.9262495322270927 | 21278291 |
Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,616,082 | -5.22 | 0.032 | ●●○○○ -1.85 | -1.8534356326320676 | 21278291 |
Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,615,763 | -4.73 | 0.047 | ●●○○○ -1.63 | -1.6317842395903992 | 21278291 |
Retrieved 4 of 4 entries in 1 ms
(Link to these results)