Bacterial taxon 155864
Locus Z1403
Protein AAG55534.1
putative regulator
Escherichia coli O157:H7 str. EDL933
Length 214 aa, Gene n/a, UniProt n/a
>AAG55534.1|Escherichia coli O157:H7 str. EDL933|putative regulator
MRPLILSIFALFLAGCTHSQQSMVDTFRASLFDNQDITVADQQIQALPYSTMYLRLNEGQRIFVVLGYIEQEQSKWLSQDNAMLVTHNGRLLKTVKLNNNLLEVTNSGQDPLRNALAIKDGSRWTRDILWSEDNHFRSATLSSTFSFAGLETLHIAGRDVLCNVWQEEVTSTLPEKQWQNTFWVDSATGQVRQSRQMLGAGVIPVEMTFLKPAP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,312,799 | -6.11 | 0.014 | ●●●○○ -2.25 | -2.2517343062592534 | 21278291 |
Retrieved 1 of 1 entries in 14.1 ms
(Link to these results)