Bacterial taxon 71421
Locus HI_1193
Protein NP_439349.1
branched-chain amino acid aminotransferase
Haemophilus influenzae Rd KW20
Length 343 aa, Gene ilvE, UniProt P54689
>NP_439349.1|Haemophilus influenzae Rd KW20|branched-chain amino acid aminotransferase
MKDLDWNNLGFSYIKTDYRFIAHWKDGKWDEGKLTTDSTLHIHEGSTALHYGQQCFEGLKAYRCKDGSINLFRPQANAERMQRTADRLLMPRVPTELFVRACKEVVKANQDWLGPYGSGATLYLRPFLIGVGENIGVKTAPEFIFSVFCCPVGAYFKGGLAPSNFITTDYDRAAPMGTGGVKVGGNYAASLLPHELAAEQGTPERKFADAIYLDPKTHTKIEEVGAANFFGITKDNKFITPKSESILPSITKYSLLHIAKERLGMEAIEGDVYIDQLDQFVEAGACGTAAVITPVGGIQHNGKFHVFDSETEVGPVTRRLYDELTGIQFGDIEAPEGWIVKVE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -5.06 | 0.00013 | ●●●●○ -3.96 | -3.958379487810266 | 19805314 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)