Bacterial taxon 71421
Locus HI_1146
Protein NP_439304.2
hypothetical protein
Haemophilus influenzae Rd KW20
Length 285 aa, Gene n/a, UniProt P45071
>NP_439304.2|Haemophilus influenzae Rd KW20|hypothetical protein
MEIIIISGRSGAGKSVALRALEDAGYYCVDNIPLDLLPQLTDILSQSQSSVAISLDIRNIPNSAHSLKQTLSTLQKHHQIKIIFLEADRATLIRRYSDSRRLHPLSLKDLSLEAAIDEEYRYLEPLIQHANLILDTTHLSTHSLAERLREFLRGNSEKELKIIVESFGFKYGIPLDADYVFDVRFLPNPHWDPTLRPMTGLEAPVAEFLNSHTEVNEFIYLTRHYIDTWLPMLEKNNRSYLTIAIGCTGGKHRSVYIAQQLGEYFQAKGKTVKIQHKSLERNKKI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.04 | 0.026 | ●●●○○ -2.26 | -2.260956168642697 | 19805314 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)