Bacterial taxon 71421
Locus HI_0846
Protein NP_439006.1
oxidoreductase
Haemophilus influenzae Rd KW20
Length 205 aa, Gene dsbA, UniProt P31810
>NP_439006.1|Haemophilus influenzae Rd KW20|oxidoreductase
MKKVLLALGLGVSTLMSVNSFAADLQEGKQYVQVSQQASQQKEVIEFFSFYCPHCYAFEMEYKIPQQVVDALPKDVKFKQYHVNFLGHQSENLTRAWALAMALGAESKVKSPLFEAAQKDALKSMDDIRAIFLSNGITAEQFDGGINSFAVNGLVNKQVNAAEQFKVRGVPDFYVNGKFRVNPEGLNYDDFVKDYVQTVKGLLQK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -5.11 | 0.00011 | ●●●●○ -4 | -3.9964541225789763 | 19805314 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)