Bacterial taxon 71421
Locus HI_0138
Protein NP_438307.1
ribonuclease H
Haemophilus influenzae Rd KW20
Length 154 aa, Gene rnhA, UniProt P43807
>NP_438307.1|Haemophilus influenzae Rd KW20|ribonuclease H
MPKQIEIFTDGSCLGNPGAGGIGAVLRYKQHEKTLSKGYFQTTNNRMELRAVIEALNTLKEPCLITLYSDSQYMKNGITKWIFNWKKNNWKASSGKPVKNQDLWIALDESIQRHKINWQWVKGHAGHRENEICDELAKKGAENPTLEDMGYIEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -4.42 | 0.00099 | ●●●●○ -3.41 | -3.4142774733374077 | 19805314 |
Retrieved 1 of 1 entries in 56.5 ms
(Link to these results)