Bacterial taxon 71421
Locus HI_0188
Protein NP_438357.1
Sec-independent protein translocase protein TatC
Haemophilus influenzae Rd KW20
Length 256 aa, Gene tatC, UniProt P44560
>NP_438357.1|Haemophilus influenzae Rd KW20|Sec-independent protein translocase protein TatC
MSNVDESQPLITHLVELRNRLLRCVICVVLVFVALVYFSNDIYHFVAAPLTAVMPKGATMIATNIQTPFFTPIKLTAIVAIFISVPYLLYQIWAFIAPALYQHEKRMIYPLLFSSTILFYCGVAFAYYIVFPLVFSFFTQTAPEGVTIATDISSYLDFALALFLAFGVCFEVPIAIILLCWTGITTVKALSEKRPYIIVAAFFIGMLLTPPDVFSQTLLAIPMCLLFELGLLVARFYQPKDDESAVKNNDESEKTQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.13 | 0.022 | ●●●○○ -2.33 | -2.3323030799151843 | 19805314 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)