Bacterial taxon 1308539
Locus VK055_1976
Protein AIK80582.1
&gamma-glutamyl:cysteine ligase YbdK
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 371 aa, Gene n/a, UniProt n/a
>AIK80582.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|&gamma-glutamyl:cysteine ligase YbdK
MPLADFHRSDPFTLGIELELQVVNPPGYDLSQDASTLIADVQHELTVGEAKHDITESMLEIATGVCRDISHAQIQLSAIQQAVQRAALRHHLQICGGGSHPFHAWQRQQISDNPRYVKTVEHFGYLAQQATVFGQHVHVGCQSGDDAIYLLHGLSRFVPHFIALNAASPWFDSTDSRFACSRLNRFSSYPDNGPMPWVADWQGFRRLFRQLSYTSMIDSMKDLHWDIRPSPQFGTVEVRVMDTPLTLAQAIHIAGFIQTLACWLLTERPFKHQPDDYLLYPFNRYQACRYGLDGTLTDVRSGEQRSIRQEILQLADRLAPFAHQLKATAALEAVVRQAKSPHSEAQQMRDFIANGGSLSGLVQKHCEIWAA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.03 | <1e-323 | ○○○○○ 0.76 | 0.7623726870462472 | 26060277 |
Retrieved 1 of 1 entries in 26.9 ms
(Link to these results)