Bacterial taxon 1308539
Locus VK055_4042
Protein AIK82589.1
2,5-diketo-D-gluconic acid reductase A
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 275 aa, Gene n/a, UniProt n/a
>AIK82589.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|2,5-diketo-D-gluconic acid reductase A
MTHPTVIKLHDGNLMPQLGLGVWKAGNEEVVSAIHKALEVGYRSFDTAAAYQNETGVGNALHSAGVNRDELFITTKLWNDDQKRPHEALKESLSKLKLDYVDLYLIHWPVPAIGHYVEAWQALIELQQQGLTKSIGVCNFQVPHLQKLIDETGVAPVINQIELHPLMQQRQLHAWNATHKIQTESWSPLAQGGEGVFDQKVIHQLADKYGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAENFDVWDFRLDKDELGAIAKLDQGKRLGPDPDQFGG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.95 | 0.00087 | ●○○○○ -0.3 | -0.30277276417836974 | 26060277 |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)