Bacterial taxon 1308539
Locus VK055_2654
Protein AIK81248.1
5-carboxymethyl-2-hydroxymuconate Delta-isomerase
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 126 aa, Gene n/a, UniProt n/a
>AIK81248.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|5-carboxymethyl-2-hydroxymuconate Delta-isomerase
MPHFIAECTDNIREQADLPGLFAKVNEALAATGIFPIGGIRSRAHWLDTWQMADGRQDYAFVHMTLKIGAGRSLESRQDVGDMLFALIKSHFATLMESRYLALSFAMEELDPTLNYKQNNVHALFK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2 | 8.4e-9 | ●○○○○ -0.86 | -0.8628428607476158 | 26060277 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)