Bacterial taxon 1308539
Locus VK055_2028
Protein AIK80634.1
ABC transporter family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 265 aa, Gene n/a, UniProt n/a
>AIK80634.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|ABC transporter family protein
MSDQTLSGLSLSHFSAGYPRRKVIENLTVPHLPRGKITALLGPNGSGKSTLMRAMAGLGPCGGELLLEGENLLTQPFSRRAEQVVYLPQTLPAGVHLHVLESIIVAQRAAGGRHSPQRQEEVMALLRQLGIAHLAMSYLDQLSGGQKQLVGLAQSLIRQPRLLLLDEPLSALDLNYQFHVMDLVRRETRRRNIVTLVVVHDINIALRHADHVLMLKAGQLLGDGTPAAVITPETLAAVYGVRGRIEPCSQGVRQVIIDGLVDSEA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.61 | 1.3e-15 | ●○○○○ -0.66 | -0.6551383229344726 | 26060277 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)