Bacterial taxon 1308539
Locus VK055_3600
Protein AIK82155.1
acetyltransferase family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 177 aa, Gene n/a, UniProt n/a
>AIK82155.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|acetyltransferase family protein
MPELLTPRLRCSPLQLDDWSFFLSLQQDPQVMLYVADPRPQAAIREAFDSRLPPWTPGDEHWLCLVVRDRLTHTPLGLTGYQHHQRDIAEVGFLFAPAAQGRGYGYESLRALCDYAFTTGGVRRLTASVTAGNEASKQLLLKAGFRLEGELRENYWLNGRWHNDWLFGRLRGEGDAP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.71 | 2.8e-10 | ○○○○○ 1.12 | 1.123741654776245 | 26060277 |
Retrieved 1 of 1 entries in 429.6 ms
(Link to these results)