Bacterial taxon 1308539
Locus VK055_4817
Protein AIK83344.1
amino ABC transporter, permease, 3-TM region, His/Glu/Gln/Arg/opine family domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 238 aa, Gene n/a, UniProt n/a
>AIK83344.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|amino ABC transporter, permease, 3-TM region, His/Glu/Gln/Arg/opine family domain protein
MIEIIQEYWKSLLWTDGYRFTGVAITLWLLISSVVMGGILAVFLAIGRVSSNKFIQFPIWLFTYIFRGTPLYVQLLVFYSGMYTLEIVKGTELLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPAGEIEAARAYGFSSVKLYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINSATYQPFTAFGIAAVLYLIISYVLISLFRKAEKRWLQHIKPSSTH
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.03 | <1e-323 | ●○○○○ -0.34 | -0.34290956167224457 | 26060277 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)