Bacterial taxon 1308539
Locus VK055_1877
Protein AIK80483.1
antimicrobial peptide resistance and lipid A acylation PagP family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 172 aa, Gene n/a, UniProt n/a
>AIK80483.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|antimicrobial peptide resistance and lipid A acylation PagP family protein
MSGNASASFSSTLSEGYHTLSNNVAQTWNEPEHYDLYVPAITWHARFAYDKEKTDKYNERPWGAGFGVSRWDEKGNWHGLYLMAFKDSFNKWEPIGGYGWEKTWRPLTDQNFHLGLGYTLGVTARDNWNYIPIPVILPLASIGYGPATFQMTYIPGTYNNGNVYFAWARIQF
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.03 | 6.4e-5 | ●○○○○ -0.34 | -0.3430581207627634 | 26060277 |
Retrieved 1 of 1 entries in 2.3 ms
(Link to these results)