Bacterial taxon 1308539
Locus VK055_4217
Protein AIK82762.1
arsenate reductase
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 136 aa, Gene n/a, UniProt n/a
>AIK82762.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|arsenate reductase
MSITIYHNPDCGTSRNTLALIRNSGAEPTVIYYLETPPSGDELRQLLAAMGIPVRALLRKNVEPYDALGLAEDRFTDDQIIDFMLQHPILINRPIVTTPQGARLCRPSEVVLEILTAPQKGAFVKEDGEPVIDAAG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.03 | 9.5e-9 | ○○○○○ 0.76 | 0.7617152824523233 | 26060277 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)