Bacterial taxon 1308539
Locus VK055_3007
Protein AIK81591.1
bacterial regulatory helix-turn-helix, AraC family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 109 aa, Gene n/a, UniProt n/a
>AIK81591.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|bacterial regulatory helix-turn-helix, AraC family protein
MSHQDIIQTLIEWIDEHIDQPLNIDIVARKSGYSKWYLQRMFRTVMHQTLGDYIRQRRLLLAAEALRTTQRPIFDIAMDLGYVSQQTFSRVFRREFDRTPSDYRHQISA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.13 | 5.6e-11 | ●○○○○ -0.4 | -0.3980500466921337 | 26060277 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)