Bacterial taxon 1308539
Locus VK055_4044
Protein AIK82591.1
bacterial regulatory helix-turn-helix, AraC family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 299 aa, Gene n/a, UniProt n/a
>AIK82591.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|bacterial regulatory helix-turn-helix, AraC family protein
MQHAEICRTLTEKINLLKDKHEMLSSLLPDVRLLYGTQPGPRTPVMYLPGIVFLFSGHKIGYINERTFRYDTNEYLLLTVPLPFECETFATPEVPLAGMRLNVDILQLQELLMDIGEDPLFQPAVASSGINSAVLSEDILCAAERLLDVMERPLDARILGKQIVREILYYVLTGPCGGALLALVSRQTHFSLISRVLKHIESQYTENLSVDRLAAEANMSVSAFHHNFKAVTSTSPLQYLKNYRLHKARMLMIHDGMKASAAAMRVGYESPSQFSREFKRYFGLTPGEDAARIRTMQGM
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.79 | 3.5e-8 | ●○○○○ -0.21 | -0.21476104097431734 | 26060277 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)