Bacterial taxon 1308539
Locus VK055_1406
Protein AIK80029.1
bacterial regulatory, tetR family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 197 aa, Gene n/a, UniProt n/a
>AIK80029.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|bacterial regulatory, tetR family protein
MSEGKVQQKQQARRAEIVVAAQKCFAEKGLHGASVADIAREAGLSVGQLYRIFASKEAIIEAIVSEIVNARVGEMIDENHNLARKAAVLAGRIPTSAATKSDNYLLMEINAEASRNPRLREILMQADRRLKEEGGRLSQRYHPGLSDARRNAASELIAVLTEGAAYRCELSASTPVDKADLEALYNMIFDRLFDEQA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 3.99 | 9.9e-6 | ○○○○○ 2.35 | 2.3467302813164683 | 26060277 |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)