Bacterial taxon 1308539
Locus VK055_1649
Protein AIK80269.1
bacterial regulatory, tetR family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 187 aa, Gene n/a, UniProt n/a
>AIK80269.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|bacterial regulatory, tetR family protein
MARRPNDPQRRERILQATLDTIAAHGIHAVTHRKIATCANVPLGSLTYYFSGIEALIEEAFSLFTAEMSAQYQQGFVGVTNREQACDAIADLIFSAQVTTARNMELMYQLYAFCSSQPALKAVMQNWMRRSQQTLEQWFAPDTARGLDAFIEGMTLHFVTDRAPLSKAAIRMMVGQLAGERAQEEGR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 3.54 | 1.1e-16 | ○○○○○ 2.11 | 2.1065115173179367 | 26060277 |
Retrieved 1 of 1 entries in 29.1 ms
(Link to these results)