Bacterial taxon 1308539
Locus VK055_4720
Protein AIK83254.1
BMC domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 96 aa, Gene n/a, UniProt n/a
>AIK83254.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|BMC domain protein
MEALGMIETRGLVALIEASDAMVKAARVKLVGVKQIGGGLVTAMVRGDVAACKAATDAGAAAAQRIGELVSVHVIPRPHGDLEEVFPISFKGDSNI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 4 | 7.8e-10 | ○○○○○ 2.35 | 2.3506827899538165 | 26060277 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)