Bacterial taxon 1308539
Locus VK055_3057
Protein AIK81642.1
branched-chain amino acid transport family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 106 aa, Gene n/a, UniProt n/a
>AIK81642.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|branched-chain amino acid transport family protein
MSNSYFIALTLGMAAVTFLIRFSFIGLAGKIQMSERVTKTLRFVPVTVLPAIITIQILSVNSSMEFDLKNPKVIAAIICTLASFRLGLVWVVVSGVGSLVLLNYFM
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.13 | 0.0041 | ●○○○○ -0.93 | -0.9345100379038758 | 26060277 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)