Bacterial taxon 1308539
Locus VK055_4311
Protein AIK82856.1
carbon dioxide concentrating mechanism protein CcmL
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 91 aa, Gene n/a, UniProt n/a
>AIK82856.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|carbon dioxide concentrating mechanism protein CcmL
MHLARVTGAVVSTQKSPSLNGKKLLLVRRVSADDDRPILPTSGDEVAVDSVGAGVGELVLLCSGSSARHVFSGPNEAIDLAVVGIVDSLSR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.97 | 1.9e-13 | ○○○○○ 0.73 | 0.727783950216947 | 26060277 |
Retrieved 1 of 1 entries in 17.6 ms
(Link to these results)