Bacterial taxon 1308539   Locus VK055_1573   Protein AIK80193.1

cold shock domain protein CspD

Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1

Length 73 aa, Gene n/a, UniProt n/a

>AIK80193.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|cold shock domain protein CspD
MEMGTVKWFNNAKGFGFICPEGGGEDIFAHYSTIQMDGYRTLKAGQAVRFDVHQGPKGNHASVIVPVEAETAA

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus C57BL/6)lung BTO:000076324 hnot available in this study-3.690.00027●●○○○ -1.77-1.771051797808358226060277
Retrieved 1 of 1 entries in 9.5 ms (Link to these results)