Bacterial taxon 1308539
Locus VK055_2082
Protein AIK80688.1
cu(I)-responsive transcriptional regulator
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 136 aa, Gene n/a, UniProt n/a
>AIK80688.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|cu(I)-responsive transcriptional regulator
MNISDVAKKTGLTSKAIRFYEEKGLVTPPLRSENGYRTYSQQHLDELTLLRQARQVGFNLEECRELVALFNDPSRHSADVKKRTLEKVADIENHIRELQNMRAHLLALAESCPGDDSAECPIIDNLSGCCHRKAQA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.05 | 4.3e-9 | ●○○○○ -0.35 | -0.3530759842892041 | 26060277 |
Retrieved 1 of 1 entries in 2.4 ms
(Link to these results)