Bacterial taxon 1308539
Locus VK055_2833
Protein AIK81422.1
cytochrome b
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 128 aa, Gene n/a, UniProt n/a
>AIK81422.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|cytochrome b
MRKKLLAMLAVSAFALGSASAFADLGEDMDTLAENLQVVQKTSDAGELKAALNKMRTAAVDAQKETPPKLEGKAADSAEMKDYRHGLDILIGQIDGALKLANEGKVKEAQAAAEEFKTTRNTYHKKYR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -4.31 | 5.5e-7 | ●●●○○ -2.1 | -2.101488344438891 | 26060277 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)