Bacterial taxon 1308539
Locus VK055_3320
Protein AIK81877.1
D-ribose utilization
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 139 aa, Gene n/a, UniProt n/a
>AIK81877.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|D-ribose utilization
MKKGTVLNADISAVISRLGHTDTLVVCDAGLPVPRSSTRIDMALTQGVPSFMQVLEVVTTEMQVEAAVIAEEIKTHNPQLHATLLTHLEQLQQHQGNTIEIRYTSHEQFKKQTADSQAVIRSGECSPFANIILCAGVTF
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.28 | <1e-323 | ●●○○○ -1.02 | -1.0159671782090247 | 26060277 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)