Bacterial taxon 1308539
Locus VK055_1654
Protein AIK80274.1
deoR-like helix-turn-helix domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 252 aa, Gene n/a, UniProt n/a
>AIK80274.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|deoR-like helix-turn-helix domain protein
METRRDERISQLIQALKRSDKLHLKEAASLLGVSEMTIRRDLNGHSGPVVLLGGYIVLEPRSATHYLLSDQKTRLVEEKRRAARHAAALLEAHQMAFFDCGTTTPWIIDAIDDALPFTGVCYSLNTFLALQEKPQCRAVLCGGEFHASNAIFMPLSLEDTLSHLSPDIAFYSAAGIDCEQGATCYNLEELPVKHWAMRHARYHVLVVDHSKFGKVRPARMGALAKFDVIASDICPDDELVALAKAQQISLLY
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.46 | 0.0063 | ●●○○○ -1.65 | -1.6471621500335134 | 26060277 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)