Bacterial taxon 1308539
Locus VK055_4304
Protein AIK82849.1
ethanolamine utilization protein, EutP
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 146 aa, Gene n/a, UniProt n/a
>AIK82849.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|ethanolamine utilization protein, EutP
MKRLMLIGPSQCGKTSLTQVLRGETLRYQKTQAIVWTPAAIDTPGEYLENRCLYSALLTSACEADVIALVLNADAPWSPFSPGFTAPMNRPVIGVITKADLAAPPRLQQVRTWLETAGAGHIFITSALTGDGLDDLFACLNAEEYQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.93 | 0.00078 | ○○○○○ 0.71 | 0.7061209200818594 | 26060277 |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)