Bacterial taxon 1308539
Locus VK055_4554
Protein AIK83092.1
flavin reductase domain protein, FMN-binding protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 190 aa, Gene n/a, UniProt n/a
>AIK83092.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|flavin reductase domain protein, FMN-binding protein
MSVQPVEISKAYRLLQVGSTTMISAKYDGVENVMSAAWVGLAGERKVVAYIGTQAFTRQLVEKSGYFVVQIPVVSQMATVLYAGGRSYADAPDKNDTIPFFYQPEFDLPLVAGCAGWLVCKVMPYPDIQQQHNLFMGDIVAAWSDDRVFRNGHWIFDDAPDELRTVHYVAGGQFYAIGKGSKFDHGPGQD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.09 | 0.00049 | ○○○○○ 0.79 | 0.78965193587335 | 26060277 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)