Bacterial taxon 1308539
Locus VK055_4157
Protein AIK82703.1
flavinator of succinate dehydrogenase family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 88 aa, Gene n/a, UniProt n/a
>AIK82703.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|flavinator of succinate dehydrogenase family protein
MDINNKARIHWACRRGMRELDISIMPFFEYEYDTLSDADKQLFIRLLENDDPDLFNWLMNHGKPADAELQRMVTLIQTRNRERGPVAI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -5.46 | 5.5e-10 | ●●●○○ -2.72 | -2.7190724061975504 | 26060277 |
Retrieved 1 of 1 entries in 11.4 ms
(Link to these results)