Bacterial taxon 1308539
Locus VK055_4459
Protein AIK83002.1
formate hydrogenlyase maturation HycH family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 136 aa, Gene n/a, UniProt n/a
>AIK83002.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|formate hydrogenlyase maturation HycH family protein
MSETVVFSQLSRKFIDENDATPDQAQQVVYYSLAIGHHLGVIDCLEAALSCPWDAYLAWIATLEAGSAARRKMEGVPKYGEIVIDSSHVAMLANAFDKAQSAQTPQQKAWSKTLLSMLHDIHQESAIYLMVRRLRD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.36 | 1.5e-7 | ○○○○○ 0.93 | 0.9346474878189869 | 26060277 |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)