Bacterial taxon 1308539
Locus VK055_1472
Protein AIK80093.1
frwB
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 113 aa, Gene n/a, UniProt n/a
>AIK80093.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|frwB
MDFNIVAVTACVSGVAHTYMAAERLEKVGHHEKWHLKVETQGALGVENRITAEDIARAEVVLLVTDIEIDDPHRFRGLRTIKTSIKSFLLQPQQIVEAVKSIMKKPVVYVELP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 2.59 | <1e-323 | ○○○○○ 1.59 | 1.594540536960699 | 26060277 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)