Bacterial taxon 1308539
Locus VK055_2915
Protein AIK81501.1
fumarate reductase membrane protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 119 aa, Gene n/a, UniProt n/a
>AIK81501.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|fumarate reductase membrane protein
MINPNPKRSDEPVFWGLFGAGGMWGAIVAPVMVLLVGILLPLGLAPADAFSYERVLAFAQSFIGRAFIFLMIVLPLWCGLHRIHHAMHDLKIHVPNGKWVFYGLAAILSVITLVGVLFI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.7 | 2.3e-8 | ●●○○○ -1.24 | -1.241890142233524 | 26060277 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)