Bacterial taxon 1308539
Locus VK055_4698
Protein AIK83232.1
gcvR GcvR predicted transcriptional regulator
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 188 aa, Gene n/a, UniProt n/a
>AIK83232.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|gcvR GcvR predicted transcriptional regulator
MTASLQHYLVITALGADRPGIVNTITRHVSSCGCNIEDSRLAMLGDEFTFIMLLSGSWNAINLIESTLPLKGAELELLIVMKRTTARPPQAMPNTVWVQVEVPDSPHIIERFTALCDTWNMNIAELVSRTQPGDGDSAQLFIQITAHSPATQNAANIEQAFKALCTELNAQGSINIVNYSQHDEQDGV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.59 | 0.00018 | ●○○○○ -0.65 | -0.6458635267581886 | 26060277 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)