Bacterial taxon 1308539   Locus VK055_3186   Protein AIK81754.1

glucose-1-phosphate thymidylyltransferase

Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1

Length 293 aa, Gene n/a, UniProt n/a

>AIK81754.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|glucose-1-phosphate thymidylyltransferase
MKGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPDDLRDFQRLLGDGSEFGIALHYAVQPTPDGLAQAFIIGEAFLNGEPACLVLGDNIFFGQSFSPKLRSVAARTEGATIFGYQVMDPERFGVVEFDDNFRALSLEEKPKQPKSNWAVTGLYFYDGKVTEYAKRVKPSERGELEITSINQMYLEDGALTVELLGRGFAWLDTGTHDSLIEASMFVQTVEKRQGFKIACLEEIGWRNGWLDDDGVKRAAKRLEKTGYGQYLLDLLRARPRQY

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus C57BL/6)lung BTO:000076324 hnot available in this study1.91<1e-323○○○○○ 1.231.2339562537301526060277
Retrieved 1 of 1 entries in 37 ms (Link to these results)