Bacterial taxon 1308539
Locus VK055_4071
Protein AIK82618.1
gram-negative pili assembly chaperone, C-terminal domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 103 aa, Gene n/a, UniProt n/a
>AIK82618.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|gram-negative pili assembly chaperone, C-terminal domain protein
MIKLFYRPSGLSMPASEAAKKLTFSNTEHGLGISNPTPYYVTLSRLNVDGKSMDVKGTEAGAMLAPFSTQYYPVNGTVRTVSWTTINDFGGESIEHQSAVKGI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.02 | 0.00082 | ●○○○○ -0.88 | -0.8757654910852666 | 26060277 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)