Bacterial taxon 1308539
Locus VK055_3986
Protein AIK82534.1
hdeA/HdeB family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 83 aa, Gene n/a, UniProt n/a
>AIK82534.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hdeA/HdeB family protein
MTSPAFAVEETTPQNMTCQEFMDMNPKSMTPVAFWVVNRNTDFSGGDYVDWHEVETVSVPKMLQECHKNPAAKLGDLSAVIKK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -4.91 | 5.7e-6 | ●●●○○ -2.42 | -2.423263398205092 | 26060277 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)