Bacterial taxon 1308539
Locus VK055_3991
Protein AIK82539.1
hdeA/HdeB family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 121 aa, Gene n/a, UniProt n/a
>AIK82539.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hdeA/HdeB family protein
MAKEKRAFWRKWVWKHLLAGITVLAMSSAAVGKDVVPDEARTRDMMRCQDYLQLDPRAWTPMVIWLMNDPFSLEPPEWTDFHEAELVLTPILTEICRQEPDVWLTSLRERLNSYQQVRSLN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.01 | 1.1e-16 | ○○○○○ 0.75 | 0.7500784748045592 | 26060277 |
Retrieved 1 of 1 entries in 12.4 ms
(Link to these results)