Bacterial taxon 1308539
Locus VK055_3955
Protein AIK82503.1
helix-turn-helix family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 200 aa, Gene n/a, UniProt n/a
>AIK82503.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|helix-turn-helix family protein
MNVKVNITTDSGSDVDQVSRAVATRLKAYRKAKKMSLDELSRRASISKGMLVEMEKEAANPSITILCKLAAALGVSVADIVNVASEPALHIIPAEQIPTLWQGPLGGSARLLAGTAGPNMIELWRWEMQPGEAFTSPGHPATTFELLHVEAGALTLTLGETCRTVAAGESAVARTEIEHGYRNEGTAPLVFTMTVAELPS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.89 | 0.00019 | ●○○○○ -0.27 | -0.2711130744181815 | 26060277 |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)