Bacterial taxon 1308539
Locus VK055_4421
Protein AIK82964.1
hokE
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 50 aa, Gene n/a, UniProt n/a
>AIK82964.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hokE
MLTKYALVAIIVLCITVLGFTLLVHSSLCELSIKERNIEFKAVLAYESKK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.07 | 2.3e-7 | ●○○○○ -0.9 | -0.9040192569612185 | 26060277 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)