Bacterial taxon 1308539   Locus VK055_1312   Protein AIK79935.1

hypothetical protein

Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1

Length 61 aa, Gene n/a, UniProt n/a

>AIK79935.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hypothetical protein
MAEHRGGSGNFAEDREKASEAGRKGGQHSGGNFKNDPQRASEAGKKGGQNSHGGGRKSDNS

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus C57BL/6)lung BTO:000076324 hnot available in this study2.234.5e-7○○○○○ 1.41.404993020471741126060277
Retrieved 1 of 1 entries in 1.7 ms (Link to these results)