Bacterial taxon 1308539
Locus VK055_1616
Protein AIK80236.1
hypothetical protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 49 aa, Gene n/a, UniProt n/a
>AIK80236.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hypothetical protein
MIGVNIWFRTEVYTLPMKREYDLSYGDDVGELIFKDFPDAIDLTWQIIE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.01 | 0.0014 | ●○○○○ -0.87 | -0.872081416600331 | 26060277 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)