Bacterial taxon 1308539
Locus VK055_1982
Protein AIK80588.1
hypothetical protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 82 aa, Gene n/a, UniProt n/a
>AIK80588.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hypothetical protein
MKHPLETLLSAAGILLLALLSCLLLPAPSLGLTLAQKLVETFHMMDLNQLYTVLFCLWFLALGAIEYLVLRWVWRRWFSLER
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.41 | 8.7e-6 | ●○○○○ -0.55 | -0.5484465743504731 | 26060277 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)