Bacterial taxon 1308539
Locus VK055_2782
Protein AIK81371.1
hypothetical protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 43 aa, Gene n/a, UniProt n/a
>AIK81371.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hypothetical protein
MPPSGTKAGMVSAVSCPAALRLPGLGYMGLQGAGDNVIGMQLY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -4.73 | 7.9e-9 | ●●●○○ -2.33 | -2.3259529715418528 | 26060277 |
Retrieved 1 of 1 entries in 37.7 ms
(Link to these results)