Bacterial taxon 1308539
Locus VK055_2991
Protein AIK81576.1
hypothetical protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 73 aa, Gene n/a, UniProt n/a
>AIK81576.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hypothetical protein
MIMLVIYVGFILLIAFAPGWLGTPLHAGTSVTRGIPLGIGVIVISFILTGIYVWRANGEFDRLTKSVLNEVKA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.87 | 3.2e-12 | ○○○○○ 0.67 | 0.6749593283563974 | 26060277 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)