Bacterial taxon 1308539
Locus VK055_3478
Protein AIK82034.1
hypothetical protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 287 aa, Gene n/a, UniProt n/a
>AIK82034.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hypothetical protein
MIRSMTAYARREIKGDWGSAAWELRSVNQRYLETYFRLPEQFRSLEPVVRERIRARLTRGKVECTLRFEQDPSAQGELILNEKLAKQLVNAANWVKMQSDEGEINPVDILRWPGVMAAKEQDLDAIAADILAALDGALDDFIVARETEGQALKALIEQRLEGVSGEVAKVRAHMPEILQWQRERLVAKLEDAEVQLENNRLEQELVLMAQRIDVAEELDRLEAHVKETYNILKKKEAVGRRLDFMMQEFNRESNTLASKSINAEVTNSAIELKVLIEQMREQIQNIE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.28 | 0.0038 | ●○○○○ -0.48 | -0.47932552657783517 | 26060277 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)